PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID model.Picochlorum_contig_84.g489.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Picochlorum
Family SBP
Protein Properties Length: 248aa    MW: 28192.7 Da    PI: 9.0214
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
model.Picochlorum_contig_84.g489.t1genomeRutgersView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP60.34.8e-191788477
                                         STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                                  SBP  4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                                         v  C+  ++e + y+rr++ C++++  + v+++g+ qrfCqqC+++  ++ fD + r+Cr  La+h errr ++
  model.Picochlorum_contig_84.g489.t1 17 V--CDCLVNEDRPYYRRYRTCRACACRERVMLRGIPQRFCQQCGKYEPVESFDVGTRTCRVALARHAERRRLQS 88
                                         4..555678999**********************************************************9765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-151174IPR004333Transcription factor, SBP-box
PROSITE profilePS5114117.761287IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-161489IPR004333Transcription factor, SBP-box
PfamPF031101.5E-171686IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGGNQTAWKN KPIHCVVCDC LVNEDRPYYR RYRTCRACAC RERVMLRGIP QRFCQQCGKY  60
EPVESFDVGT RTCRVALARH AERRRLQSEK KRQQSKSDGQ ETSRKRHANM FYPKPLHVAS  120
PNLAEASLAE EKRTSIFACA KAESIKYGTI QRISEGNEIS PSQVLGTLHG IIRSYFYPPR  180
NGERNGNNSL STDSTESSES TEDTEDQVRQ LVRARHAISD EDMQQVVEIL NWCLAAKGEN  240
KRPNPQP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-1118851178squamosa promoter binding protein-like 7
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-09SBP family protein